Loading...
Statistics

Home - 单多多RT-18主题外贸站
www.womentopic.com/
Advertisement

Womentopic.com

Home Conversion Technology Metas Server
Womentopic.com is hosted in United States / Canyon Country . Womentopic.com uses HTTPS protocol. Number of used technologies: 8. First technologies: Carousel, CSS, Flexslider, Number of used javascripts: 15. First javascripts: Jquery.js, Jquery-migrate.min.js, Modernizr.min.js, Number of used analytics tools: 0. Number of used plugins, modules: 3. Its server type is: LiteSpeed. Its CMS is: Wordpress.

Technologies in use by Womentopic.com

Technology

Number of occurences: 8
  • Carousel
  • CSS
  • Flexslider
  • Html
  • Javascript
  • jQuery
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 15
  • jquery.js
  • jquery-migrate.min.js
  • modernizr.min.js
  • jquery.form.min.js
  • scripts.js
  • jquery.easing.1.3.js
  • jquery.tools.min.js
  • waypoints.min.js
  • mediaelement-and-player.min.js
  • jackbox-packed.min.js
  • colortip-1.0-jquery.js
  • jquery.flexslider.js
  • script.js
  • comment-reply.min.js
  • owl.carousel.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • LiteSpeed

Powered by

  • PHP/5.3.29

Used plugins, modules

Number of plugins and modules: 3
  • contact form 7
  • easy table
  • my live chat for wp

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Womentopic.com

SSL certificate

    • name: /CN=mulan.safesugar.net
    • subject:
      • CN: mulan.safesugar.net
    • hash: 80497284
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 344103374142287938836835258908658965199855
    • validFrom: 160629220000Z
    • validTo: 160927220000Z
    • validFrom_time_t: 1467237600
    • validTo_time_t: 1475013600
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 31:86:15:84:9E:6B:C8:68:C2:E4:27:DC:31:D1:AB:4A:7A:6F:A6:88
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:mulan.safesugar.net
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Womentopic.com

Number of occurences: 4
  • Name:
    Content: 单多多RT-18主题外贸站
  • Name: viewport
    Content: width=device-width, initial-scale=1, maximum-scale=1
  • Name: robots
    Content: noindex,follow,noodp,noydir
  • Name: generator
    Content: WordPress 4.1.12

Server / Hosting

  • IP: 23.234.195.188
  • Latitude: 34.41
  • Longitude: -118.40
  • Country: United States
  • City: Canyon Country

Rname

  • ns2.dnsowl.com
  • ns3.dnsowl.com
  • ns1.dnsowl.com

Target

  • hostmaster.dnsowl.com

HTTP Header Response

HTTP/1.1 200 OK X-Powered-By: PHP/5.3.29 X-Pingback: http://womentopic.com/xmlrpc.php Content-Type: text/html; charset=UTF-8 Date: Thu, 30 Jun 2016 03:28:36 GMT Accept-Ranges: bytes Server: LiteSpeed X-Cache: MISS from s_xt40 X-Cache-Lookup: MISS from s_xt40:80 Via: 1.1 s_xt40 (squid/3.5.14) Connection: keep-alive

DNS

host: womentopic.com
  1. class: IN
  2. ttl: 172817
  3. type: A
  4. ip: 23.234.195.188
host: womentopic.com
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns2.dnsowl.com
host: womentopic.com
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns3.dnsowl.com
host: womentopic.com
  1. class: IN
  2. ttl: 172800
  3. type: NS
  4. target: ns1.dnsowl.com
host: womentopic.com
  1. class: IN
  2. ttl: 172800
  3. type: SOA
  4. mname: ns1.dnsowl.com
  5. rname: hostmaster.dnsowl.com
  6. serial: 1467257138
  7. refresh: 7200
  8. retry: 1800
  9. expire: 1209600
  10. minimum-ttl: 600

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.omentopic.com, www.w omentopic.com, www. omentopic.com, www.wcomentopic.com, www.comentopic.com, www.womentopic.com, www.omentopic.com, www.wdomentopic.com, www.domentopic.com, www.wfomentopic.com, www.fomentopic.com, www.wgomentopic.com, www.gomentopic.com, www.wbomentopic.com, www.bomentopic.com, www.wmentopic.com, www.wobmentopic.com, www.wbmentopic.com, www.wohmentopic.com, www.whmentopic.com, www.wogmentopic.com, www.wgmentopic.com, www.wojmentopic.com, www.wjmentopic.com, www.wommentopic.com, www.wmmentopic.com, www.wo mentopic.com, www.w mentopic.com, www.wovmentopic.com, www.wvmentopic.com, www.woentopic.com, www.wompentopic.com, www.wopentopic.com, www.womoentopic.com, www.wooentopic.com, www.womientopic.com, www.woientopic.com, www.womkentopic.com, www.wokentopic.com, www.wom.entopic.com, www.wo.entopic.com, www.womuentopic.com, www.wouentopic.com, www.womjentopic.com, www.wojentopic.com, www.womnentopic.com, www.wonentopic.com, www.wom-entopic.com, www.wo-entopic.com, www.womntopic.com, www.womexntopic.com, www.womxntopic.com, www.womesntopic.com, www.womsntopic.com, www.womewntopic.com, www.womwntopic.com, www.womerntopic.com, www.womrntopic.com, www.womefntopic.com, www.womfntopic.com, www.womevntopic.com, www.womvntopic.com, www.womecntopic.com, www.womcntopic.com, www.womeqntopic.com, www.womqntopic.com, www.womeantopic.com, www.womantopic.com, www.womeyntopic.com, www.womyntopic.com, www.wometopic.com, www.womenntopic.com, www.womentopic.com, www.womenhtopic.com, www.womehtopic.com, www.womenjtopic.com, www.womejtopic.com, www.womenktopic.com, www.womektopic.com, www.womenltopic.com, www.womeltopic.com, www.women topic.com, www.wome topic.com, www.womenopic.com, www.womentqopic.com, www.womenqopic.com, www.womentaopic.com, www.womenaopic.com, www.woment opic.com, www.women opic.com, www.womentwopic.com, www.womenwopic.com, www.womenteopic.com, www.womeneopic.com, www.womentzopic.com, www.womenzopic.com, www.womentxopic.com, www.womenxopic.com, www.womentcopic.com, www.womencopic.com, www.womentpic.com, www.womentobpic.com, www.womentbpic.com, www.womentohpic.com, www.womenthpic.com, www.womentogpic.com, www.womentgpic.com, www.womentojpic.com, www.womentjpic.com, www.womentompic.com, www.womentmpic.com, www.womento pic.com, www.woment pic.com, www.womentovpic.com, www.womentvpic.com, www.womentoic.com, www.womentopiic.com, www.womentoiic.com, www.womentopkic.com, www.womentokic.com, www.womentopuic.com, www.womentouic.com, www.womentopjic.com, www.womentojic.com, www.womentoplic.com, www.womentolic.com, www.womentopc.com, www.womentopirc.com, www.womentoprc.com, www.womentopifc.com, www.womentopfc.com, www.womentopivc.com, www.womentopvc.com, www.womentopikc.com, www.womentopkc.com, www.womentopi,c.com, www.womentop,c.com, www.womentopibc.com, www.womentopbc.com, www.womentopigc.com, www.womentopgc.com, www.womentopitc.com, www.womentoptc.com, www.womentopiyc.com, www.womentopyc.com, www.womentopiuc.com, www.womentopuc.com, www.womentopijc.com, www.womentopjc.com, www.womentopimc.com, www.womentopmc.com, www.womentopinc.com, www.womentopnc.com, www.womentopi.com, www.womentopicd.com, www.womentopid.com, www.womentopicr.com, www.womentopir.com, www.womentopict.com, www.womentopit.com, www.womentopicv.com, www.womentopiv.com, www.womentopicf.com, www.womentopif.com, www.womentopicg.com, www.womentopig.com, www.womentopich.com, www.womentopih.com, www.womentopicn.com, www.womentopin.com, www.womentopicm.com, www.womentopim.com, www.womentopicj.com, www.womentopij.com,

Other Reviews

  1. Home | Staffing Company in United States - SIARP Technologies LLC
    SIARP, a New Jersey based IT and Staffing solutions provider, is one of the fastest growing companies across the USA.
    Burnaby (Canada) - 65.61.216.12
    G Analytics ID: UA-71381903-1
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Font Awesome, Html, Html5, Javascript, jQuery Validate, jQuery UI, MediaElement, Modernizr.js, SVG, Google Analytics
    Number of Javascript: 22
    Number of meta tags: 4
  2. Welcome to CRIMINALDEFENSELAWYERSLASVEGAS.COM
    Scottsdale (United States) - 184.168.221.96
    Server software: Microsoft-IIS/7.5
    Technology: Google Adsense, CSS, Html, Javascript
    Number of Javascript: 3
    Number of meta tags: 2
  3. Home - Flagstone Farm Flagstone Farm
    Provo (United States) - 69.195.124.98
    Server software: nginx/1.10.0
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 18
    Number of meta tags: 3
  4. bestinhome.com
    Dallas (United States) - 75.126.102.254
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  5. FARUK BEY İNŞAAT-Maltepesatılık,Maltepe kiralik Emlak İlanları
    Maltepe satılık daire Maltepe kiralık daire Maltepe arsa Maltepe işyeri Maltepe konut Aydınevler FARUK BEY İNŞAAT
    Turkey - 85.111.30.247
    Server software: Sahibinden Web Servers
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 5
    Number of meta tags: 4
  6. exif .nl Exchangeable image file format is a specification for the image file format used by digital cameras
    digitaal bestands uitwissel protocol exif. Exchangeable Image File Format.
    Netherlands - 217.119.1.22
    Server software: Apache/2.4.10 (Unix) OpenSSL/1.0.1e-fips PHP/5.6.24
    Technology: Google Adsense, CSS, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 4
  7. mbregistryonline.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  8. fregattehessen.club
    Germany - 217.160.122.208
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  9. Het Ministerie van Financiën
    Netherlands - 83.96.141.85
    G Analytics ID: UA-73256160-1
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Php, SVG, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 7
  10. schönpfeffer-invocem
    Germany - 46.252.20.114
    Server software: Apache/2.4.20
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 1